AibGenesis™ Mouse Anti-MFSD12 Antibody (CBMOAB-51231FYA)


Cat: CBMOAB-51231FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51231FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO51231FYA 100 µg
MO-AB-05149H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05149C 100 µg
MO-AB-18091W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18091W 100 µg
MO-AB-59034W Monoclonal Marmoset WB, ELISA MO59034W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO51231FYA
SpecificityThis antibody binds to Rhesus MFSD12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMFSD12 (Major Facilitator Superfamily Domain Containing 12) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus MFSD12 Antibody is a mouse antibody against MFSD12. It can be used for MFSD12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMFSD12
UniProt IDI2CYE2
Protein RefseqThe length of the protein is 480 amino acids long.
The sequence is show below: MGPGPPAAGAAPSRRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGLLLLLGQVADGLCTPLVGYEADRAAGCCPRYGPRKAWHLVGTVCVLLSFPFIFSPCLGCGAATPEWAALLYYGPFIVIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDIDIGDQLGGQDVPMFRNLSLLVVGVGAVFSLLFHLGTRERRRPHVEEPGEHTPLLAPAVAQPLLLWKHWLREPAFYQVGVLYMTTRLIVNLSQTYMAMYLTYSLHLPKKFIATIPLVMYLSGFFSSFLMKPINKRIGRNMTYFLGLLVILAFAAWVALAEGLGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFSDKVANGLAVMAIQSLHPCPSELCCRACVSFYHWAMVAVTGGVGVAAALCLCSLLLWPIRLRRWDPDARP.
For Research Use Only | Not For Clinical Use.
Online Inquiry