Mouse Anti-MFSD3 Antibody (CBMOAB-51241FYA)


Cat: CBMOAB-51241FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51241FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO51241FYA 100 µg
MO-AB-15617R Monoclonal Cattle (Bos taurus) WB, ELISA MO15617R 100 µg
MO-AB-22594W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22594W 100 µg
MO-AB-59036W Monoclonal Marmoset WB, ELISA MO59036W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO51241FYA
SpecificityThis antibody binds to Rhesus MFSD3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MFSD3 Antibody is a mouse antibody against MFSD3. It can be used for MFSD3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMajor facilitator superfamily domain-containing protein 3; MFSD3
UniProt IDI2CW43
Protein RefseqThe length of the protein is 412 amino acids long.
The sequence is show below: MHGKLLPLAGLYLVQGLPYGLQSGLLPVLLRAGGLSLTRVGLAKVLYTPWLLKLAWAPLVDAQGSVRAWLTRSTAGLGLVCGLLAGLPPPGAGQAGLPAAVAGLLLLLNLGAAVQDVALDALAVQLLEPAELGPGNTVQVVAYKLGAALAGGALLALQPTLSWPQLFLLLAATYWLAAALAWAAPALRRLPQPAPSKQRPHTAHLLRDVLAVPGTLWTAGFVLTYKLGEQGASSLFPLLLLDHGVSAPELGLWNGVGAVVCSIAGSSLGGTLLAKHWELLPLLRSVLRLRFGGLACQTALVFHLDTLGASMGPGTILRGSALLSLCLQHFLGGLVTTVTFTGMMRCSQLAPRALQATHYSLLATLELLGKLLLGALAGGLADGLGPHPCFFLLLILSALPVLYLGLAPSTFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry