AibGenesis™ Mouse Anti-Mgp Antibody (MO-AB-27079H)
Cat: MO-AB-27079H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-27079H | Monoclonal | Rat (Rattus norvegicus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos) | WB, ELISA | MO27079C | 100 µg | ||
| MO-AB-08651W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08651W | 100 µg | ||
| MO-AB-19498W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19498W | 100 µg | ||
| MO-AB-23439H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23439C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rat (Rattus norvegicus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos) |
| Clone | MO27079C |
| Specificity | This antibody binds to Rat Mgp. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the osteocalcin/matrix Gla family of proteins. The encoded vitamin K-dependent protein is secreted by chondrocytes and vascular smooth muscle cells, and functions as a physiological inhibitor of ectopic tissue calcification. Carboxylation status of the encoded protein is associated with calcification of the vasculature in human patients with cardiovascular disease and calcification of the synovial membranes in osteoarthritis patients. Mutations in this gene cause Keutel syndrome in human patients, which is characterized by abnormal cartilage calcification, peripheral pulmonary stenosis and facial hypoplasia. (From NCBI) |
| Product Overview | This product is a mouse antibody against Mgp. It can be used for Mgp detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Matrix Gla protein; MGP; Mgp |
| UniProt ID | Q5RK05 |
| Protein Refseq | The length of the protein is 103 amino acids long. The sequence is show below: MKSLLPLAILAALAVAALCYESHESMESYEVSPFTNRRNANTFISPQQRWHAKAQERVRELNKPAQEINREACDDYKLCERYALIYGYNAAYNRYFRQRRGAK. |
See other products for " MGP "
| MO-AB-45501W | AibGenesis™ Mouse Anti-MGP Antibody (MO-AB-45501W) |
| CBMOAB-86739FYA | AibGenesis™ Mouse Anti-mgp Antibody (CBMOAB-86739FYA) |
| MO-AB-27280R | AibGenesis™ Mouse Anti-MGP Antibody (MO-AB-27280R) |
| MO-AB-15746R | AibGenesis™ Mouse Anti-MGP Antibody (MO-AB-15746R) |
| CBMOAB-51268FYA | AibGenesis™ Mouse Anti-MGP Antibody (CBMOAB-51268FYA) |
| MO-AB-08811Y | AibGenesis™ Mouse Anti-MGP Antibody (MO-AB-08811Y) |
| MO-AB-59058W | AibGenesis™ Mouse Anti-MGP Antibody (MO-AB-59058W) |
| CBMOAB-36481FYC | AibGenesis™ Mouse Anti-MGP Antibody (CBMOAB-36481FYC) |
| MO-AB-05160H | AibGenesis™ Mouse Anti-mgp Antibody (MO-AB-05160H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry