AibGenesis™ Mouse Anti-Mgp Antibody (MO-AB-27079H)


Cat: MO-AB-27079H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-27079H Monoclonal Rat (Rattus norvegicus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos) WB, ELISA MO27079C 100 µg
MO-AB-08651W Monoclonal Cat (Felis catus) WB, ELISA MO08651W 100 µg
MO-AB-19498W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19498W 100 µg
MO-AB-23439H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23439C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos)
CloneMO27079C
SpecificityThis antibody binds to Rat Mgp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the osteocalcin/matrix Gla family of proteins. The encoded vitamin K-dependent protein is secreted by chondrocytes and vascular smooth muscle cells, and functions as a physiological inhibitor of ectopic tissue calcification. Carboxylation status of the encoded protein is associated with calcification of the vasculature in human patients with cardiovascular disease and calcification of the synovial membranes in osteoarthritis patients. Mutations in this gene cause Keutel syndrome in human patients, which is characterized by abnormal cartilage calcification, peripheral pulmonary stenosis and facial hypoplasia. (From NCBI)
Product OverviewThis product is a mouse antibody against Mgp. It can be used for Mgp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMatrix Gla protein; MGP; Mgp
UniProt IDQ5RK05
Protein RefseqThe length of the protein is 103 amino acids long.
The sequence is show below: MKSLLPLAILAALAVAALCYESHESMESYEVSPFTNRRNANTFISPQQRWHAKAQERVRELNKPAQEINREACDDYKLCERYALIYGYNAAYNRYFRQRRGAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry