AibGenesis™ Mouse Anti-MIC2 Antibody (CBMOAB-51398FYA)


Cat: CBMOAB-51398FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51398FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO51398FYA 100 µg
MO-AB-15785R Monoclonal Cattle (Bos taurus) WB, ELISA MO15785R 100 µg
MO-AB-59074W Monoclonal Marmoset WB, ELISA MO59074W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO51398FYA
SpecificityThis antibody binds to Rhesus MIC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MIC2 Antibody is a mouse antibody against MIC2. It can be used for MIC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMIC2 protein; MIC2
UniProt IDQ5TM16
Protein RefseqThe length of the protein is 386 amino acids long.
The sequence is show below: MGLGRVLLFLGRVLLFLASIFSFTRPRAAAELHSLRYNVTVLSRDGSVQSEFLAEGHLDGQLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIKICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMNFWKEDTMKTNTHYRAMRADCLKKLWRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWRQDGVSLSHDAQQWGDVLPDWNGTYQTWVATRIRQGEEQRFACYMEHSGNHSTHPVPSGKPPVLQSERLNLLYVPVAVAVAVVTAFIIICVHRCKKKKTSAAEGPELVSLRTLDQHPVGTGDHRDATQLGFQPLMSAPGSTGSTEGA.
For Research Use Only | Not For Clinical Use.
Online Inquiry