Mouse Anti-MICOS10 Antibody (MO-AB-23577W)
Cat: MO-AB-23577W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-23577W | Monoclonal | Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO23577W | 100 µg | ||
| MO-AB-27085H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27085C | 100 µg | ||
| MO-AB-59083W | Monoclonal | Marmoset | WB, ELISA | MO59083W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO23577W |
| Specificity | This antibody binds to Chimpanzee MICOS10. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Chimpanzee MICOS10 Antibody is a mouse antibody against MICOS10. It can be used for MICOS10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Chromosome 1 open reading frame 151; MINOS1 |
| UniProt ID | H2PY72 |
| Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry