AibGenesis™ Mouse Anti-MIOX Antibody (CBMOAB-51445FYA)


Cat: CBMOAB-51445FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51445FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) WB, ELISA MO51445FYA 100 µg
CBMOAB-86964FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86964FYA 100 µg
MO-AB-05185H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05185C 100 µg
MO-AB-15811R Monoclonal Cattle (Bos taurus) WB, ELISA MO15811R 100 µg
MO-AB-34898H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34898C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio)
CloneMO51445FYA
SpecificityThis antibody binds to Rhesus MIOX.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MIOX Antibody is a mouse antibody against MIOX. It can be used for MIOX detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMIOX
UniProt IDF7EE36
Protein RefseqThe length of the protein is 231 amino acids long.
The sequence is show below: MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRGKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKVPNLPCPSPSQTGSTLLGSCTTWGRSWPCSGSPSGRSSETPSLSDAVPRLPWFSATPPSRTTLTSRILDTAQNSACISPTAGSTGSSCPGATMQVRPLHQVPGPAGCGQAAALLPGAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry