AibGenesis™ Mouse Anti-mitd1 Antibody (CBMOAB-86977FYA)


Cat: CBMOAB-86977FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-86977FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO86977FYA 100 µg
MO-AB-05189H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05189C 100 µg
MO-AB-11853W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11853W 100 µg
MO-AB-15817R Monoclonal Cattle (Bos taurus) WB, ELISA MO15817R 100 µg
MO-AB-27115H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27115C 100 µg
MO-AB-59131W Monoclonal Marmoset WB, ELISA MO59131W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO86977FYA
SpecificityThis antibody binds to Zebrafish mitd1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAbscission, the separation of daughter cells at the end of cytokinesis, is effected by endosomal sorting complexes required for transport III (ESCRT-III). The protein encoded by this gene functions as a homodimer, with the N-termini binding to a subset of ESCRT-III subunits and the C-termini binding to membranes. The encoded protein regulates ESCRT-III activity and is required for proper cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish mitd1 Antibody is a mouse antibody against mitd1. It can be used for mitd1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesmitd1; Microtubule Interacting And Trafficking Domain Containing 1
UniProt IDB0S8J9
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: MAQDLLPGVESSAVSVLKRAVQLDNCSRFQEALVCYQEGIQLLLDVLKAVKDEAKKMHYREKIKGYMERAEQIKEHTTKLKEEGKYHEQIKIADSSTGYSYESLFKPYITDGLTEVWVEDPYVRHVHQLYNFLRFCEMLLKCPSTVKTIHLLTSQDEDSSTQQSSALAEMKQSLLSKDICLDIQYSSTIHDREIRFNNGWIIKIGRGLDYFKKPKGRFSVGYCDYDLRECHETTVDIFHTKHTKKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry