Mouse Anti-mle Antibody (MO-AB-70051W)


Cat: MO-AB-70051W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-70051W Monoclonal Silkworm (Bombyx mori), Fruit fly (Drosophila melanogaster) WB, ELISA MO70051W 100 µg
CBMOAB-24383FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO24383FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori), Fruit fly (Drosophila melanogaster)
CloneMO70051W
SpecificityThis antibody binds to Silkworm mle.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired in males for dosage compensation of X chromosome linked genes. Mle, msl-1 and msl-3 are colocalized on X chromosome. Each of the msl proteins requires all the other msls for wild-type X-chromosome binding. Probably unwinds double-stranded DNA and RNA in a 3'' to 5'' direction. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Silkworm mle Antibody is a mouse antibody against mle. It can be used for mle detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMariner transposase; mle
UniProt IDQ9Y1K1
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: WVPHELSEKNLNDRIIICTSLLAHNKIEPFLDRIITGYEKWITYENIIRKRAFYEPGKPAPSTSKPKLSLNKRMLCIWWNIRRPMHFELLKPNERLNSERHCQQFDKLKTALQEKRPAMFNRKDIVLLHDNARPHAALGTRQKAAELG.
For Research Use Only | Not For Clinical Use.
Online Inquiry