AibGenesis™ Mouse Anti-MLP Antibody (CBMOAB-61939FYC)


Cat: CBMOAB-61939FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61939FYC Monoclonal A. thaliana (Arabidopsis thaliana), O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO61939FYC 100 µg
MO-AB-06644Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06644Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), O. anatinus (Ornithorhynchus anatinus)
CloneMO61939FYC
SpecificityThis antibody binds to A. thaliana MLP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-A. thaliana MLP Antibody is a mouse antibody against MLP. It can be used for MLP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMajor latex protein; MLP
UniProt IDQ42173
Protein RefseqThe length of the protein is 109 amino acids long.
The sequence is show below: MAMSGKYVAEVPLKGSAEKHYRRWRSQNNLFPDAIGHHVQGVTVHDGDWDSHGSIKFWNYTLDGKPEVIKEKREIDDEKMALTFRGLEGHVMEKYKKYEVILQFIPKSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry