AibGenesis™ Mouse Anti-mmgt1 Antibody (CBMOAB-87096FYA)


Cat: CBMOAB-87096FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87096FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO87096FYA 100 µg
MO-AB-13086W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13086W 100 µg
MO-AB-15856R Monoclonal Cattle (Bos taurus) WB, ELISA MO15856R 100 µg
MO-AB-27128H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27128C 100 µg
MO-AB-59183W Monoclonal Marmoset WB, ELISA MO59183W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO87096FYA
SpecificityThis antibody binds to Zebrafish mmgt1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Golgi apparatus; Endoplasmic reticulum; Other locations; Plasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mmgt1 Antibody is a mouse antibody against mmgt1. It can be used for mmgt1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMembrane magnesium transporter 1; ER membrane protein complex subunit 5; Transmembrane protein 32; mmgt1; emc5 tmem3
UniProt IDQ6TLE4
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MASSFWKGVVGIGLFALAHAAFSAAQHRSYMRLTEKENETLPIDIVLQTLLSFVITCYGIVHISGEFKDMDASSELKNKTFDTLRNHPSFYLFNHRGRVLFRTPEQEPSTPNAQALPSNPLRLRKLENFH.
For Research Use Only | Not For Clinical Use.
Online Inquiry