Mouse Anti-Mob3 Antibody (CBMOAB-24441FYA)


Cat: CBMOAB-24441FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24441FYA Monoclonal Fruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO24441FYA 100 µg
MO-AB-12097Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12097Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss)
CloneMO24441FYA
SpecificityThis antibody binds to fruit fly Mob3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Mob3 Antibody is a mouse antibody against Mob3. It can be used for Mob3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOB kinase activator-like 3; Mob as tumor suppressor protein 3; Dmob3; Mps one binder kinase activator-like 3; Mob3
UniProt IDQ9VL13
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MALNGFLEFFQKGKTFRPKKPFASGTIRYSLHKQAQASLQSGINLRQVVRLPQGENLNDWLAVHVVDFFNRINLIYGTVSEFCNETTCPTMSGGSRYEYLWADGDLYKKPTALSAQKYIEHLMDWIETQINNEAVFPVSTDVPFPKNFIAISRKILTRLFRVFVHVYIHHFDRIVSIGAEAHVNACYKHFYYFVQEFDMISAKELEPLQEMTSRICKDKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry