AibGenesis™ Mouse Anti-mob3c Antibody (CBMOAB-87178FYA)


Cat: CBMOAB-87178FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87178FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO87178FYA 100 µg
MO-AB-05251H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05251C 100 µg
MO-AB-15897R Monoclonal Cattle (Bos taurus) WB, ELISA MO15897R 100 µg
MO-AB-27138H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27138C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO87178FYA
SpecificityThis antibody binds to Zebrafish mob3c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. (From NCBI)
Product OverviewMouse Anti-Zebrafish mob3c Antibody is a mouse antibody against mob3c. It can be used for mob3c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOB1, Mps One Binder kinase activator-like 2C; Yeast; mob3c; mobkl2c; NP_001002191.1;XP_005156004.1;XP_005156005.
UniProt IDQ6GQN1
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MALCLGQVFSKDKTFRPRKRFEPGTQRFELYKRAQASLKSGLDLRKVVQLPEGESINDWIAVHVVDFFNRINLIYGTVSEFCTEKSCPIMSGGPRYEYRWQDGEQYKRPTKLPALIYMNLLMNWIESLINNEDIFPTRVGVPFPKNFQQVCKKILSRLFRVFVHVYIHHFDMICSIGAEAHINTCYKHYYYFISEFSLIDHSELVPLKEMTEKICH.
For Research Use Only | Not For Clinical Use.
Online Inquiry