Mouse Anti-Mocs2 Antibody (CBMOAB-24452FYA)
Cat: CBMOAB-24452FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-24452FYA | Monoclonal | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO24452FYA | 100 µg | ||
CBMOAB-34678FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO34678FYB | 100 µg | ||
CBMOAB-36630FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO36630FC | 100 µg | ||
CBMOAB-51565FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51565FYA | 100 µg | ||
CBMOAB-87185FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87185FYA | 100 µg | ||
MO-AB-00819L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00819L | 100 µg | ||
MO-AB-08855Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08855Y | 100 µg | ||
MO-AB-09168W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09168W | 100 µg | ||
MO-AB-12100Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12100Y | 100 µg | ||
MO-AB-15904R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15904R | 100 µg | ||
MO-AB-16178Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16178Y | 100 µg | ||
MO-AB-24689W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24689W | 100 µg | ||
MO-AB-27141H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27141C | 100 µg | ||
MO-AB-27346R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27346R | 100 µg | ||
MO-AB-31813W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31813W | 100 µg | ||
MO-AB-33419H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33419C | 100 µg | ||
MO-AB-35131W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35131W | 100 µg | ||
MO-AB-38614W | Monoclonal | Gorilla | WB, ELISA | MO38614W | 100 µg | ||
MO-AB-43285W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43285W | 100 µg | ||
MO-AB-45537W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45537W | 100 µg | ||
MO-AB-59218W | Monoclonal | Marmoset | WB, ELISA | MO59218W | 100 µg | ||
MO-AB-70053W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70053W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
Clone | MO24452FYA |
Specificity | This antibody binds to fruit fly Mocs2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. |
Product Overview | Mouse Anti-D. melanogaster Mocs2 Antibody is a mouse antibody against Mocs2. It can be used for Mocs2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Molybdopterin synthase catalytic subunit; EC 2.8.1.12; Molybdenum cofactor synthesis protein 2 large subunit; Molybdenum cofactor synthesis protein 2B; MOCS2B; Mocs2 |
UniProt ID | Q9VBX2 |
Protein Refseq | The length of the protein is 367 amino acids long. The sequence is show below: MDHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEMNKICSDLRSKWLDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKEIYDGDNDSEWKENKESIRPKKSKSGFNYAACPCKVEESHDVPRTLVQIRVNDAELTKRLECFVNRKRDEINSQNVIDFKSSFVSSDQNLSDSCARTQSTIIKQEQSNCHLKVRRVNNRCGPQQMEMRPNYELELNKLMGSRDGQTDPTKEMRKSLPNSRLQAIESYMGLTTDNEENIFSRIKRVENRLLQLESISPEYRHFTKREPSSMEAAPPKKSRKKSYSAQELSAFIQKIKDGSELS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry