Mouse Anti-MOG Antibody (MO-AB-12102Y)
Cat: MO-AB-12102Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-12102Y | Monoclonal | O. mykiss (Oncorhynchus mykiss), Bovine, Mouse, Rat, Cattle (Bos taurus), E. coli (Escherichia coli ), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO12102Y | 100 µg | ||
| CBMOAB-1726YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO1726YC | 100 µg | ||
| CBMOAB-51566FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51566FYA | 100 µg | ||
| MO-AB-59222W | Monoclonal | Marmoset | WB, ELISA | MO59222W | 100 µg | ||
| MO-AB-15911R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15911R | 100 µg | ||
| MO-AB-27347R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27347R | 100 µg | ||
| MO-AB-27143H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27143C | 100 µg | ||
| MOFY-0722-FY349 | Polyclonal | Bovine, Mouse, Rat | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | O. mykiss (Oncorhynchus mykiss), Bovine, Mouse, Rat, Cattle (Bos taurus), E. coli (Escherichia coli ), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO12102Y |
| Specificity | This antibody binds to O. mykiss MOG. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Product Overview | This product is a mouse antibody against MOG. It can be used for MOG detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Myelin-oligodendrocyte glycoprotein; MOG |
| UniProt ID | C1BHF9 |
| Protein Refseq | The length of the protein is 213 amino acids long. The sequence is show below: MKTFPTSAVWCFGILFISVALITTGLSEVQVVGPADPVVALAGDDIILPCSLKPNVSAEDMTVEWTGLYPTTRNVHLYRDGRDSNEEQFPSYRRRTSMFHEELKNGNVSLKLNRVTLSDAGSYRCLIPTLTSQMKDTTVQLFVVPTPIPSPAVPVLSMSLPRLLCSLLVGSPYLLVTIILLVKGCRSRTRGETRVPRKTHQDQLGDRVEEEWG. |
See other products for " MOG "
| MOFY-0722-FY100 | Biotin conjugated antibody to MOG Antibody (MOFY-0722-FY100) |
| MOFY-0722-FY446 | Rabbit Anti-MOG Antibody (MOFY-0722-FY446) |
For Research Use Only | Not For Clinical Use.
Online Inquiry