Mouse Anti-MOGAT2 Antibody (CBMOAB-51573FYA)


Cat: CBMOAB-51573FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51573FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO51573FYA 100 µg
CBMOAB-87193FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87193FYA 100 µg
MO-AB-15914R Monoclonal Cattle (Bos taurus) WB, ELISA MO15914R 100 µg
MO-AB-27349R Monoclonal Pig (Sus scrofa) WB, ELISA MO27349R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO51573FYA
SpecificityThis antibody binds to Rhesus MOGAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzyme that catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. The encoded protein is important in the uptake of dietary fat by the small intestine. This protein forms a complex with diacylglycerol O-acyltransferase 2 in the endoplasmic reticulum, and this complex catalyzes the synthesis of triacylglycerol. (From NCBI)
Product OverviewMouse Anti-Rhesus MOGAT2 Antibody is a mouse antibody against MOGAT2. It can be used for MOGAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOGAT2
UniProt IDF6YBC1
Protein RefseqThe length of the protein is 334 amino acids long.
The sequence is show below: MVEFAPLFVPWERRLQTLAVLQFVFSFLALAEICIVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRRVQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIVGFHPHGVLAAGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFIRLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRCIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC.
For Research Use Only | Not For Clinical Use.
Online Inquiry