Mouse Anti-Mpp6 Antibody (CBMOAB-24527FYA)


Cat: CBMOAB-24527FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24527FYA Monoclonal Fruit fly (Drosophila melanogaster), Yeast WB, ELISA MO24527FYA 100 µg
CBMOAB-02366CR Monoclonal Yeast WB, ELISA MO02366CR 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Yeast
CloneMO24527FYA
SpecificityThis antibody binds to fruit fly Mpp6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMembers of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains. MPP6 is a member of the p55-like MAGUK subfamily (Tseng et al., 2001 [PubMed 11311936]).
Product OverviewMouse Anti-D. melanogaster Mpp6 Antibody is a mouse antibody against Mpp6. It can be used for Mpp6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG9250-PA; M phase phosphoprotein 6; M-phase phosphoprotein 6, isoform B; RE45276p; Mpp6
UniProt IDQ95PE4
Protein RefseqThe length of the protein is 162 amino acids long.
The sequence is show below: MPSKSKPRLSRGVLDMKFMQRTKVKVEKEADDEQSRALYSNEINQKMLNSTSNFVVESSYSICAGLIDGRLSFRGMNPELELLMEQDLAEKQGRTRPEQPKEVSDQDMVKAYYANKAPTVSGSMSKKFNTKKDFKRKQIGGDSDSPHAMKKQYFKKPRSGDE.
For Research Use Only | Not For Clinical Use.
Online Inquiry