Mouse Anti-MPV17 Antibody (CBMOAB-51662FYA)


Cat: CBMOAB-51662FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51662FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO51662FYA 100 µg
CBMOAB-87295FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87295FYA 100 µg
MO-AB-12749W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12749W 100 µg
MO-AB-15949R Monoclonal Cattle (Bos taurus) WB, ELISA MO15949R 100 µg
MO-AB-27167H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27167C 100 µg
MO-AB-59284W Monoclonal Marmoset WB, ELISA MO59284W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO51662FYA
SpecificityThis antibody binds to Rhesus MPV17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). (From NCBI)
Product OverviewMouse Anti-Rhesus MPV17 Antibody is a mouse antibody against MPV17. It can be used for MPV17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMPV17
UniProt IDF7B8F6
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMMSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMMLDQGGFAPCFLGCFLPLVGALNGLSAKDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYREDPASTTLVSIPPGAPPLMAYLEGQWLGCCSLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry