Mouse Anti-MRGPRF Antibody (CBMOAB-51682FYA)


Cat: CBMOAB-51682FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51682FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset WB, ELISA MO51682FYA 100 µg
MO-AB-12165W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12165W 100 µg
MO-AB-15970R Monoclonal Cattle (Bos taurus) WB, ELISA MO15970R 100 µg
MO-AB-45544W Monoclonal Horse (Equus caballus) WB, ELISA MO45544W 100 µg
MO-AB-59310W Monoclonal Marmoset WB, ELISA MO59310W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset
CloneMO51682FYA
SpecificityThis antibody binds to Rhesus MRGPRF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MRGPRF Antibody is a mouse antibody against MRGPRF. It can be used for MRGPRF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMRGPRF
UniProt IDF7GP83
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: QMCPGMSEAPELYSRGFLTIEQITMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLARIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPVVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry