Mouse Anti-MRPL12 Antibody (MO-AB-15984R)
Cat: MO-AB-15984R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-15984R | Monoclonal | Cattle (Bos taurus), C. elegans (Caenorhabditis elegans), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO15984R | 100 µg | ||
| CBMOAB-51706FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51706FYA | 100 µg | ||
| CBMOAB-87354FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87354FYA | 100 µg | ||
| CBMOAB-06800HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO06800HB | 100 µg | ||
| MO-AB-59322W | Monoclonal | Marmoset | WB, ELISA | MO59322W | 100 µg | ||
| MO-AB-05298H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05298C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), C. elegans (Caenorhabditis elegans), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO15984R |
| Specificity | This antibody binds to Cattle MRPL12. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which forms homodimers. In prokaryotic ribosomes, two L7/L12 dimers and one L10 protein form the L8 protein complex. |
| Product Overview | Mouse Anti-Cattle MRPL12 Antibody is a mouse antibody against MRPL12. It can be used for MRPL12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 39S ribosomal protein L12, mitochondrial; MRPL12 protein; MRPL12 |
| UniProt ID | A5PJ86 |
| Protein Refseq | The length of the protein is 226 amino acids long. The sequence is show below: MLPSATSLLRGPCLGLRAAALRLVRQQVPHVCAVRLMRCSSHRRGEALTGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGAAPAPTAPEAAEEDVPKQKERTHFTVRLTEAKPVDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVFWSSCPGDCGQGSRALSGALPALRPAPRLSG. |
See other products for " Mrpl12 "
| CBMOAB-24683FYA | Mouse Anti-Mrpl12 Antibody (CBMOAB-24683FYA) |
| MO-AB-20028W | Mouse Anti-MRPL12 Antibody (MO-AB-20028W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry