Mouse Anti-MRPL12 Antibody (MO-AB-15984R)


Cat: MO-AB-15984R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15984R Monoclonal Cattle (Bos taurus), C. elegans (Caenorhabditis elegans), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO15984R 100 µg
CBMOAB-51706FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO51706FYA 100 µg
CBMOAB-87354FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87354FYA 100 µg
CBMOAB-06800HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06800HB 100 µg
MO-AB-59322W Monoclonal Marmoset WB, ELISA MO59322W 100 µg
MO-AB-05298H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05298C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), C. elegans (Caenorhabditis elegans), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO15984R
SpecificityThis antibody binds to Cattle MRPL12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which forms homodimers. In prokaryotic ribosomes, two L7/L12 dimers and one L10 protein form the L8 protein complex.
Product OverviewMouse Anti-Cattle MRPL12 Antibody is a mouse antibody against MRPL12. It can be used for MRPL12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names39S ribosomal protein L12, mitochondrial; MRPL12 protein; MRPL12
UniProt IDA5PJ86
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MLPSATSLLRGPCLGLRAAALRLVRQQVPHVCAVRLMRCSSHRRGEALTGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGAAPAPTAPEAAEEDVPKQKERTHFTVRLTEAKPVDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVFWSSCPGDCGQGSRALSGALPALRPAPRLSG.
For Research Use Only | Not For Clinical Use.
Online Inquiry