Mouse Anti-MRPL19 Antibody (MO-AB-10522W)


Cat: MO-AB-10522W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10522W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset WB, ELISA MO10522W 100 µg
MO-AB-59329W Monoclonal Marmoset WB, ELISA MO59329W 100 µg
MO-AB-15992R Monoclonal Cattle (Bos taurus) WB, ELISA MO15992R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset
CloneMO10522W
SpecificityThis antibody binds to Chimpanzee MRPL19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. (From NCBI)
Product OverviewMouse Anti-Chimpanzee MRPL19 Antibody is a mouse antibody against MRPL19. It can be used for MRPL19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial ribosomal protein L19; MRPL19
UniProt IDH2QI77
Protein RefseqThe length of the protein is 292 amino acids long.
The sequence is show below: MAACIAAGHWAAMGLGRSFQAARTLLPPPASIACRVHAGPVRQQSTGPSEPGAFQPPPKPVIVDKHRPVEPERRFLSPEFIPRRGRTDPLKFQIERKDMLERRKVLHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKDAQKWNQPWLEFDMMREYDTSKIEAAIWKEIEASKRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry