Mouse Anti-MRPL40 Antibody (CBMOAB-02417CR)
Cat: CBMOAB-02417CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02417CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO02417CR | 100 µg | ||
| CBMOAB-06826HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO06826HB | 100 µg | ||
| CBMOAB-24724FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO24724FYA | 100 µg | ||
| CBMOAB-87402FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87402FYA | 100 µg | ||
| MO-AB-05310H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05310C | 100 µg | ||
| MO-AB-22465W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22465W | 100 µg | ||
| MO-AB-27208H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27208C | 100 µg | ||
| MO-AB-59351W | Monoclonal | Marmoset | WB, ELISA | MO59351W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO02417CR |
| Specificity | This antibody binds to Yeast MRPL40. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Sequence analysis identified alternatively spliced variants that encode different protein isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Yeast MRPL40 Antibody is a mouse antibody against MRPL40. It can be used for MRPL40 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 54S ribosomal protein L40, mitochondrial; YmL40; MRPL40; YPL173W |
| UniProt ID | P36534 |
| Protein Refseq | The length of the protein is 297 amino acids long. The sequence is show below: MSGSYQHLSNVGSRVMKRLGNRPKNFLPHSEKFIKKSTPEFMKSDLKEVDEKTSFKSEKEWKFIPGDRVVVMSGASKGNIAVIKSFDKRTNSFILDENGPTKTVPVPKQFWLEGQTSHMITIPVSILGKDLRLVADIDDEKTPGKTRTVAVRDVSFNGSYYDADYKKVMPYRCVKGQPDLIIPWPKPDPIDVQTNLATDPVIAREQTFWVDSVVRNPIPKKAIPSIRNPHSKYKRGTLTAKDIAKLVAPEMPLTEVRKSHLAEKKELAEREVPKLTEEDMEAIGARVFEFLEKQKRE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry