Mouse Anti-Mrpl42 Antibody (CBMOAB-24726FYA)


Cat: CBMOAB-24726FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24726FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO24726FYA 100 µg
CBMOAB-51736FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO51736FYA 100 µg
MO-AB-14384W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14384W 100 µg
MO-AB-16014R Monoclonal Cattle (Bos taurus) WB, ELISA MO16014R 100 µg
MO-AB-27211H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27211C 100 µg
MO-AB-59352W Monoclonal Marmoset WB, ELISA MO59352W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO24726FYA
SpecificityThis antibody binds to fruit fly Mrpl42.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein identified as belonging to both the 28S and the 39S subunits. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 4q, 6p, 6q, 7p, and 15q. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Mrpl42 Antibody is a mouse antibody against Mrpl42. It can be used for Mrpl42 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial ribosomal protein L42; RE72116p; mRpL42; mRpS32
UniProt IDQ7K0A0
Protein RefseqThe length of the protein is 124 amino acids long.
The sequence is show below: MSAARLYGGFRLFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVARQELMQLTHTTKHRWFPRARDRKAKQTPMDRPYL.
For Research Use Only | Not For Clinical Use.
Online Inquiry