Mouse Anti-Mrpl42 Antibody (CBMOAB-24726FYA)
Cat: CBMOAB-24726FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-24726FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO24726FYA | 100 µg | ||
| CBMOAB-51736FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51736FYA | 100 µg | ||
| MO-AB-14384W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14384W | 100 µg | ||
| MO-AB-16014R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16014R | 100 µg | ||
| MO-AB-27211H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27211C | 100 µg | ||
| MO-AB-59352W | Monoclonal | Marmoset | WB, ELISA | MO59352W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO24726FYA |
| Specificity | This antibody binds to fruit fly Mrpl42. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein identified as belonging to both the 28S and the 39S subunits. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 4q, 6p, 6q, 7p, and 15q. |
| Product Overview | Mouse Anti-D. melanogaster Mrpl42 Antibody is a mouse antibody against Mrpl42. It can be used for Mrpl42 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mitochondrial ribosomal protein L42; RE72116p; mRpL42; mRpS32 |
| UniProt ID | Q7K0A0 |
| Protein Refseq | The length of the protein is 124 amino acids long. The sequence is show below: MSAARLYGGFRLFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVARQELMQLTHTTKHRWFPRARDRKAKQTPMDRPYL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry