AibGenesis™ Mouse Anti-Mrpl44 Antibody (CBMOAB-24728FYA)
Cat: CBMOAB-24728FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-24728FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) | WB, ELISA | MO24728FYA | 100 µg | ||
| CBMOAB-51740FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51740FYA | 100 µg | ||
| CBMOAB-87409FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87409FYA | 100 µg | ||
| CBMOAB-02418CR | Monoclonal | Yeast | WB, ELISA | MO02418CR | 100 µg | ||
| MO-AB-21509W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21509W | 100 µg | ||
| MO-AB-59356W | Monoclonal | Marmoset | WB, ELISA | MO59356W | 100 µg | ||
| MO-AB-16016R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16016R | 100 µg | ||
| MO-AB-05312H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05312C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) |
| Clone | MO24728FYA |
| Specificity | This antibody binds to fruit fly Mrpl44. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. (From NCBI) |
| Product Overview | Mouse Anti-D. melanogaster Mrpl44 Antibody is a mouse antibody against Mrpl44. It can be used for Mrpl44 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | LD10028p; Fragment; mRpL44 |
| UniProt ID | Q7K141 |
| Protein Refseq | The length of the protein is 334 amino acids long. The sequence is show below: KTYSLLIFKIALKMSFLRSAVGLLARVKLLEGSPTVQTRRHIKRWVSPTLRELAHRQKKLGPQKPERRSGFVEWNQRSELFAFGKRLGESFELSELQRAFTEKSFAEREEDRRRQLGIEESDLQMPHNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLAHVSTHLGTKDLIQSTEYPPSAESQAKSLHAVIGALASSSGIERAFIFVRDFICTQLNQKDLLEVWTPQEPIQLLEKICQERKLGEAEPRLLGDCGKNTVLAAYQVGIYANRQLLGKGFGEDVKTATETAALDALQSIFDTRDNRRPFDFAIQLEPKTVRLG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry