Mouse Anti-Mrpl44 Antibody (CBMOAB-24728FYA)


Cat: CBMOAB-24728FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24728FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) WB, ELISA MO24728FYA 100 µg
CBMOAB-51740FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO51740FYA 100 µg
CBMOAB-87409FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87409FYA 100 µg
CBMOAB-02418CR Monoclonal Yeast WB, ELISA MO02418CR 100 µg
MO-AB-21509W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21509W 100 µg
MO-AB-59356W Monoclonal Marmoset WB, ELISA MO59356W 100 µg
MO-AB-16016R Monoclonal Cattle (Bos taurus) WB, ELISA MO16016R 100 µg
MO-AB-05312H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05312C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio)
CloneMO24728FYA
SpecificityThis antibody binds to fruit fly Mrpl44.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Mrpl44 Antibody is a mouse antibody against Mrpl44. It can be used for Mrpl44 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD10028p; Fragment; mRpL44
UniProt IDQ7K141
Protein RefseqThe length of the protein is 334 amino acids long.
The sequence is show below: KTYSLLIFKIALKMSFLRSAVGLLARVKLLEGSPTVQTRRHIKRWVSPTLRELAHRQKKLGPQKPERRSGFVEWNQRSELFAFGKRLGESFELSELQRAFTEKSFAEREEDRRRQLGIEESDLQMPHNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLAHVSTHLGTKDLIQSTEYPPSAESQAKSLHAVIGALASSSGIERAFIFVRDFICTQLNQKDLLEVWTPQEPIQLLEKICQERKLGEAEPRLLGDCGKNTVLAAYQVGIYANRQLLGKGFGEDVKTATETAALDALQSIFDTRDNRRPFDFAIQLEPKTVRLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry