Mouse Anti-Mrpl48 Antibody (CBMOAB-24735FYA)
Cat: CBMOAB-24735FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-24735FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO24735FYA | 100 µg | ||
CBMOAB-51746FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51746FYA | 100 µg | ||
CBMOAB-87421FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87421FYA | 100 µg | ||
MO-AB-05313H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05313C | 100 µg | ||
MO-AB-16022R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16022R | 100 µg | ||
MO-AB-23888W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23888W | 100 µg | ||
MO-AB-27214H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27214C | 100 µg | ||
MO-AB-45548W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45548W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO24735FYA |
Specificity | This antibody binds to fruit fly Mrpl48. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 6p. Several transcript variants, some protein-coding and some non-protein coding, have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-D. melanogaster Mrpl48 Antibody is a mouse antibody against Mrpl48. It can be used for Mrpl48 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CG17642-PA; Mitochondrial ribosomal protein L48, isoform B; RE01048p; mRpL48 |
UniProt ID | Q9VQ35 |
Protein Refseq | The length of the protein is 181 amino acids long. The sequence is show below: MLRRILPSVRLALQVPKATTTAVRSTSGSVYEPDYLESLKPKFPQYESLNVQIKGYDYPQLESYQRFLHGLAEYLDLDVSDCYALPPQKTTVQRLRPNSTVIESEYKLTTYERNLQLNNVDAPVYPQFLRLAQAALPEGVSLQVQEYTDDCEERRYVPDKELLDLKDELERMGGPTTTRKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry