Mouse Anti-MRPL49 Antibody (CBMOAB-02419CR)
Cat: CBMOAB-02419CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02419CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO02419CR | 100 µg | ||
| CBMOAB-06832HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO06832HB | 100 µg | ||
| CBMOAB-24738FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO24738FYA | 100 µg | ||
| MO-AB-11159W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11159W | 100 µg | ||
| MO-AB-16026R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16026R | 100 µg | ||
| MO-AB-27215H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27215C | 100 µg | ||
| MO-AB-59359W | Monoclonal | Marmoset | WB, ELISA | MO59359W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO02419CR |
| Specificity | This antibody binds to Yeast MRPL49. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. Pseudogenes corresponding to this gene are found on chromosomes 5q and 8p. |
| Product Overview | Mouse Anti-Yeast MRPL49 Antibody is a mouse antibody against MRPL49. It can be used for MRPL49 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 54S ribosomal protein L49, mitochondrial; YmL49; MRPL49; YJL096W |
| UniProt ID | P40858 |
| Protein Refseq | The length of the protein is 161 amino acids long. The sequence is show below: MLQLKFIWPVARITPIYRPFTSHPFRNLATSSSISSTKAKTTKTDTTPLKLSNELYAIFKIHNRPYLVTEGDRVILPFKLKQAEVGDILNMTDVTTLGSRNYKLVGHPINTSLYTLKATVVGKTKRAFQTREVTKRRNRRVRHAKSKGDLTILRISELSMN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry