Mouse Anti-MRPL52 Antibody (MO-AB-16029R)


Cat: MO-AB-16029R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16029R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO16029R 100 µg
MO-AB-27218H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27218C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO16029R
SpecificityThis antibody binds to Cattle MRPL52.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis.
Product OverviewMouse Anti-Cattle MRPL52 Antibody is a mouse antibody against MRPL52. It can be used for MRPL52 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names39S ribosomal protein L52, mitochondrial; L52mt; MRP-L52; MRPL52
UniProt IDP0C2B7
Protein RefseqThe length of the protein is 124 amino acids long.
The sequence is show below: MAALGMLLSTGVRRLHCGSAARAGSQWRLRQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAQREKFARRVVLLSQEMDAGLQAWQLRQQEKLQEEKRKQQNALKPKGVLLQNPGPSQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry