Mouse Anti-MRPS16 Antibody (CBMOAB-02427CR)


Cat: CBMOAB-02427CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02427CR Monoclonal Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO02427CR 100 µg
CBMOAB-06844HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06844HB 100 µg
CBMOAB-24753FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO24753FYA 100 µg
CBMOAB-87435FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87435FYA 100 µg
MO-AB-05317H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05317C 100 µg
MO-AB-16047R Monoclonal Cattle (Bos taurus) WB, ELISA MO16047R 100 µg
MO-AB-26064W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26064W 100 µg
MO-AB-27228H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27228C 100 µg
MO-AB-35147W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35147W 100 µg
MO-AB-59368W Monoclonal Marmoset WB, ELISA MO59368W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO02427CR
SpecificityThis antibody binds to Yeast MRPS16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described.
Product OverviewMouse Anti-Yeast MRPS16 Antibody is a mouse antibody against MRPS16. It can be used for MRPS16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names37S ribosomal protein S16, mitochondrial; MRPS16; YPL013C
UniProt IDQ02608
Protein RefseqThe length of the protein is 121 amino acids long. The sequence is show below: MTCGLVRIRLARFGRKNSPVYNIVVANSRKARDAKPIEVLGTYVPVPSPVTKRELKRGVVPIKDVKLDFDRTKYWIGVGAQPSETVTKLLRKAGILNDAWATSKNSNVNRKVVFERMETLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry