Mouse Anti-Mrps34 Antibody (MO-AB-27241H)


Cat: MO-AB-27241H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-27241H Monoclonal Rat (Rattus norvegicus), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO27241C 100 µg
CBMOAB-51775FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO51775FYA 100 µg
CBMOAB-06860HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06860HB 100 µg
MO-AB-13367W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13367W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO27241C
SpecificityThis antibody binds to Rat Mrps34.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against Mrps34. It can be used for Mrps34 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial ribosomal protein S34, isoform CRA_a; Protein Mrps34; Mrps34
UniProt IDD4ABM5
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MARKKVKPRLIAELARRVRALREQRNQPRDSQLYALDYETLTRPHSGRRLPVRAWADVRRESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGRAWGILTFKGKSEETAREIEQVMYHDWRLVPKHEEEAFTAFTGKAEDRLNLVPYPPLLRAMILAERQKNGDTSVEEPLLNLERTRMRPWDYPAKQETKGRAKGTPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry