AibGenesis™ Mouse Anti-Mrps34 Antibody (MO-AB-27241H)
Cat: MO-AB-27241H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-27241H | Monoclonal | Rat (Rattus norvegicus), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) | WB, ELISA | MO27241C | 100 µg | ||
| CBMOAB-51775FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51775FYA | 100 µg | ||
| CBMOAB-06860HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO06860HB | 100 µg | ||
| MO-AB-13367W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13367W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rat (Rattus norvegicus), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) |
| Clone | MO27241C |
| Specificity | This antibody binds to Rat Mrps34. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | This product is a mouse antibody against Mrps34. It can be used for Mrps34 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mitochondrial ribosomal protein S34, isoform CRA_a; Protein Mrps34; Mrps34 |
| UniProt ID | D4ABM5 |
| Protein Refseq | The length of the protein is 218 amino acids long. The sequence is show below: MARKKVKPRLIAELARRVRALREQRNQPRDSQLYALDYETLTRPHSGRRLPVRAWADVRRESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGRAWGILTFKGKSEETAREIEQVMYHDWRLVPKHEEEAFTAFTGKAEDRLNLVPYPPLLRAMILAERQKNGDTSVEEPLLNLERTRMRPWDYPAKQETKGRAKGTPV. |
See other products for " mrps34 "
| MO-AB-05327H | AibGenesis™ Mouse Anti-mrps34 Antibody (MO-AB-05327H) |
| CBMOAB-24776FYA | AibGenesis™ Mouse Anti-Mrps34 Antibody (CBMOAB-24776FYA) |
| MO-AB-59402W | AibGenesis™ Mouse Anti-MRPS34 Antibody (MO-AB-59402W) |
| CBMOAB-87468FYA | AibGenesis™ Mouse Anti-mrps34 Antibody (CBMOAB-87468FYA) |
| MO-AB-16070R | AibGenesis™ Mouse Anti-MRPS34 Antibody (MO-AB-16070R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry