Mouse Anti-MS4A15 Antibody (CBMOAB-51795FYA)


Cat: CBMOAB-51795FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51795FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO51795FYA 100 µg
MO-AB-27248H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27248C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO51795FYA
SpecificityThis antibody binds to Rhesus MS4A15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MS4A15 Antibody is a mouse antibody against MS4A15. It can be used for MS4A15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMS4A15
UniProt IDF7HTQ4
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MVRRGHVGMFFIEGGVPFWGGACFIISGSLSVAAEKNHASCLVRSSLGANILSAMAAFAGTAILLMDFGVTNWDVDRGYLAVLAIFTILEFFIAVIATHFGCQATCAQVNAPVIFLPNAFSADFNIPSPAASPPPAYDNVAYMPKES.
For Research Use Only | Not For Clinical Use.
Online Inquiry