AibGenesis™ Mouse Anti-MSMP Antibody (CBMOAB-51823FYA)


Cat: CBMOAB-51823FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51823FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO51823FYA 100 µg
Inquiry
MO-AB-27265H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27265C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO51823FYA
SpecificityThis antibody binds to Rhesus MSMP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. (From NCBI)
Product OverviewMouse Anti-Rhesus MSMP Antibody is a mouse antibody against MSMP. It can be used for MSMP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProstate-associated microseminoprotein; MSMP
UniProt IDH9F1U7
Protein RefseqThe length of the protein is 41 amino acids long.
The sequence is show below: MALRMLWAGQAKGILGGWGIVCLVMSLLLQHPGVYSKCYFQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry