Mouse Anti-MSRB3 Antibody (CBMOAB-34731FYB)


Cat: CBMOAB-34731FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34731FYB Monoclonal Rice (Oryza), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO34731FYB 100 µg
CBMOAB-87582FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87582FYA 100 µg
MO-AB-04493W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04493W 100 µg
MO-AB-24346W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24346W 100 µg
MO-AB-59447W Monoclonal Marmoset WB, ELISA MO59447W 100 µg
MO-AB-27271H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27271C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO34731FYB
SpecificityThis antibody binds to Rice MSRB3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. (From NCBI)
Product OverviewMouse Anti-Rice MSRB3 Antibody is a mouse antibody against MSRB3. It can be used for MSRB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeptide methionine sulfoxide reductase B3, chloroplastic; OsMSRB3; EC 1.8.4.12; Peptide-methionine (R)-S-oxide reductase; MSRB3; Os05g0404200 LOC_Os05g33510
UniProt IDQ6AUK5
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MGVQHLLKLRMASPHPHPHPGAPLAARPLSALASFFLARPSSTAAAPPPRHVTLSCSRPHCNHNQWAASRCRGTAGRRRLQVVVAMSSSAPPPPPGSVQKSEEEWEAILSPEQFRILRLKGTEYPGTGEYDKLFAEGVYECAGCGTPLYKSSTKFNSGCGWPAFYEGFPGAIARTPDPDGRRIEITCAACGGHLGHVFKGEGFNTPTDERHCVNSISLKFIPASEDSKL.
See other products for " MSRB3 "
For Research Use Only | Not For Clinical Use.
Online Inquiry