Mouse Anti-MSRB3 Antibody (CBMOAB-34731FYB)
Cat: CBMOAB-34731FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-34731FYB | Monoclonal | Rice (Oryza), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO34731FYB | 100 µg | ||
| CBMOAB-87582FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87582FYA | 100 µg | ||
| MO-AB-04493W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04493W | 100 µg | ||
| MO-AB-24346W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24346W | 100 µg | ||
| MO-AB-59447W | Monoclonal | Marmoset | WB, ELISA | MO59447W | 100 µg | ||
| MO-AB-27271H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27271C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rice (Oryza), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO34731FYB |
| Specificity | This antibody binds to Rice MSRB3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. (From NCBI) |
| Product Overview | Mouse Anti-Rice MSRB3 Antibody is a mouse antibody against MSRB3. It can be used for MSRB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Peptide methionine sulfoxide reductase B3, chloroplastic; OsMSRB3; EC 1.8.4.12; Peptide-methionine (R)-S-oxide reductase; MSRB3; Os05g0404200 LOC_Os05g33510 |
| UniProt ID | Q6AUK5 |
| Protein Refseq | The length of the protein is 229 amino acids long. The sequence is show below: MGVQHLLKLRMASPHPHPHPGAPLAARPLSALASFFLARPSSTAAAPPPRHVTLSCSRPHCNHNQWAASRCRGTAGRRRLQVVVAMSSSAPPPPPGSVQKSEEEWEAILSPEQFRILRLKGTEYPGTGEYDKLFAEGVYECAGCGTPLYKSSTKFNSGCGWPAFYEGFPGAIARTPDPDGRRIEITCAACGGHLGHVFKGEGFNTPTDERHCVNSISLKFIPASEDSKL. |
See other products for " MSRB3 "
| CBMOAB-36761FYC | Mouse Anti-MSRB3 Antibody (CBMOAB-36761FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry