Mouse Anti-mt-atp6 Antibody (CBMOAB-87627FYA)


Cat: CBMOAB-87627FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87627FYA Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Donkey (Equus asinus), Elephant (Loxodonta africana), Goat (Capra hircus), Hamsters (Cricetinae), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO87627FYA 100 µg
MO-AB-00826L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00826L 100 µg
MO-AB-08787W Monoclonal Cat (Felis catus) WB, ELISA MO08787W 100 µg
MO-AB-08878Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08878Y 100 µg
MO-AB-27282H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27282C 100 µg
MO-AB-34266W Monoclonal Donkey (Equus asinus) WB, ELISA MO34266W 100 µg
MO-AB-37723W Monoclonal Goat (Capra hircus) WB, ELISA MO37723W 100 µg
MO-AB-43293W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43293W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Donkey (Equus asinus), Elephant (Loxodonta africana), Goat (Capra hircus), Hamsters (Cricetinae), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO87627FYA
SpecificityThis antibody binds to Zebrafish mt-atp6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mt-atp6 Antibody is a mouse antibody against mt-atp6. It can be used for mt-atp6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase subunit a; F-ATPase protein 6; mt-atp6; atp6 atpase6 mtatp
UniProt IDQ9MIY5
Protein RefseqThe length of the protein is 227 amino acids long.
The sequence is show below: MMTSFFDQFASPYLLGIPLILVAMLLPWLLFPAPTSRWINNRLITVQTWLTGRFTNQLMTPLNFSGHKWALLFASLMVFLITINLLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMKNQPTIALGHLLPEGTPIPLIPALIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAVFVLLPMMPAVAILTASVLFLLTLLEVAVAMIQAYVFILLLSLYLQENI.
For Research Use Only | Not For Clinical Use.
Online Inquiry