AibGenesis™ Mouse Anti-MT1F Antibody (CBMOAB-51844FYA)


Cat: CBMOAB-51844FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51844FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO51844FYA 100 µg
MO-AB-15154W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15154W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO51844FYA
SpecificityThis antibody binds to Rhesus MT1F.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MT1F Antibody is a mouse antibody against MT1F. It can be used for MT1F detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMetallothionein; MT1F
UniProt IDF6PZW8
Protein RefseqThe length of the protein is 61 amino acids long.
The sequence is show below: MDPNCSCAAGDSCSCAGSCTCKECKCTSCKKSCCSRYRVGCAKCAQGYVCKGASETCSCCD.
For Research Use Only | Not For Clinical Use.
Online Inquiry