AibGenesis™ Mouse Anti-MTCP1 Antibody (CBMOAB-51853FYA)
Cat: CBMOAB-51853FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-51853FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO51853FYA | 100 µg | ||
| MO-AB-16140R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16140R | 100 µg | ||
| MO-AB-27286H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27286C | 100 µg | ||
| MO-AB-59471W | Monoclonal | Marmoset | WB, ELISA | MO59471W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO51853FYA |
| Specificity | This antibody binds to Rhesus MTCP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus MTCP1 Antibody is a mouse antibody against MTCP1. It can be used for MTCP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein p13 MTCP-1; MTCP1 |
| UniProt ID | H9FB33 |
| Protein Refseq | The length of the protein is 43 amino acids long. The sequence is show below: LPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry