Mouse Anti-mtx1 Antibody (MO-AB-05379H)


Cat: MO-AB-05379H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05379H Monoclonal Frog (Xenopus laevis), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Rhesus (Macaca mulatta) WB, ELISA MO05379C 100 µg
CBMOAB-06915HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06915HB 100 µg
MO-AB-04517W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04517W 100 µg
MO-AB-16206R Monoclonal Cattle (Bos taurus) WB, ELISA MO16206R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Rhesus (Macaca mulatta)
CloneMO05379C
SpecificityThis antibody binds to Frog mtx1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against mtx1. It can be used for mtx1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC407749 protein; Metaxin 1; mtx1; LOC407749
UniProt IDQ6PKY5
Protein RefseqThe length of the protein is 320 amino acids long.
The sequence is show below: MAAPMELYCWKGDWGLPSVDPDCLTVLTYAKFSGAPLKVHKITNPWRSPSGRLPALKTSDDGVLFQPSRIITHLRKQKYNADYDLSARQGADTLAFISLLEEKLLPALIHSFWVEGKNYVEHTRKWYAESIPFPLNFFLPNQMHKRNMERLKLIRGESWREEDEEMEGRLYTDAHECLSLLSQRLANNNFFFGDSPASLDAYVFSHLAPILNAKLPNNKLQQHLSSLPNLCRYCTSIITVYFPWEQESGPRVAPKPPSAETQDTEDDPHKRRNQVLSVLAGLLAMVGYAVLSGIVSIQRVAPDHALEQGITMEDNEEEEE.
See other products for " MTX1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry