Mouse Anti-MYC Antibody (CBMOAB-52008FYA)


Cat: CBMOAB-52008FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52008FYA Monoclonal Rhesus (Macaca mulatta), Avian, Human, Mouse, Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), D. melanogaster (Drosophila melanogaster), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Fruit fly (Drosophila melanogaster), Insect, Yeast, Mallard (Anas platyrhynchos), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO52008FYA 100 µg
MO-AB-03025Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03025Y 100 µg
MO-AB-05395H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05395C 100 µg
MO-AB-09453W Monoclonal Cat (Felis catus) WB, ELISA MO09453W 100 µg
MO-AB-10125W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10125W 100 µg
MO-AB-12129Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12129Y 100 µg
MO-AB-16231Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16231Y 100 µg
MO-AB-16273R Monoclonal Cattle (Bos taurus) WB, ELISA MO16273R 100 µg
MO-AB-23485H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23485C 100 µg
MO-AB-27436R Monoclonal Pig (Sus scrofa) WB, ELISA MO27436R 100 µg
MO-AB-31855W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31855W 100 µg
MO-AB-35156W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35156W 100 µg
MOFY-0522-FY164 Monoclonal Avian, Human, Mouse IHC, IP, WB 100 µg
MO-NAB-00006W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Fruit fly (Drosophila melanogaster) WB, ChIP, ELISA, FC, FC-IC, IB, IF, IHC, IHC-Fr, IHC-P, IP 9E10 100 µg
MO-NAB-00248W Monoclonal Human (Homo sapiens), Yeast WB, ELISA, IHC, IHC-Fr, IHC-P, IP, IF 9E10 100 µg
MO-NAB-00831W Monoclonal D. melanogaster (Drosophila melanogaster) ChIP, IF, IHC, IP, WB NW0753 100 µg
MO-DKB-00580W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Insect, Yeast WB, Simple Western, ChIP, ELISA, IF, IHC, IHC-P, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Avian, Human, Mouse, Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), D. melanogaster (Drosophila melanogaster), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Fruit fly (Drosophila melanogaster), Insect, Yeast, Mallard (Anas platyrhynchos), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO52008FYA
SpecificityThis antibody binds to Rhesus MYC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.
Product OverviewMouse Anti-Rhesus MYC Antibody is a mouse antibody against MYC. It can be used for MYC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMYC; MYC
UniProt IDA2D666
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECXXPSVVFPYPLNDSSSPKSCASPXXSAFSPSSDSLLSSTESSPQASPEPXVLHEETPPTTSSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry