Mouse Anti-MYC Antibody (CBMOAB-52008FYA)
Cat: CBMOAB-52008FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-52008FYA | Monoclonal | Rhesus (Macaca mulatta), Avian, Human, Mouse, Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), D. melanogaster (Drosophila melanogaster), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Fruit fly (Drosophila melanogaster), Insect, Yeast, Mallard (Anas platyrhynchos), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Sheep (Ovis aries) | WB, ELISA | MO52008FYA | 100 µg | ||
MO-AB-03025Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03025Y | 100 µg | ||
MO-AB-05395H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05395C | 100 µg | ||
MO-AB-09453W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09453W | 100 µg | ||
MO-AB-10125W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10125W | 100 µg | ||
MO-AB-12129Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12129Y | 100 µg | ||
MO-AB-16231Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16231Y | 100 µg | ||
MO-AB-16273R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16273R | 100 µg | ||
MO-AB-23485H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23485C | 100 µg | ||
MO-AB-27436R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27436R | 100 µg | ||
MO-AB-31855W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31855W | 100 µg | ||
MO-AB-35156W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35156W | 100 µg | ||
MOFY-0522-FY164 | Monoclonal | Avian, Human, Mouse | IHC, IP, WB | 100 µg | |||
MO-NAB-00006W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Fruit fly (Drosophila melanogaster) | WB, ChIP, ELISA, FC, FC-IC, IB, IF, IHC, IHC-Fr, IHC-P, IP | 9E10 | 100 µg | ||
MO-NAB-00248W | Monoclonal | Human (Homo sapiens), Yeast | WB, ELISA, IHC, IHC-Fr, IHC-P, IP, IF | 9E10 | 100 µg | ||
MO-NAB-00831W | Monoclonal | D. melanogaster (Drosophila melanogaster) | ChIP, IF, IHC, IP, WB | NW0753 | 100 µg | ||
MO-DKB-00580W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Insect, Yeast | WB, Simple Western, ChIP, ELISA, IF, IHC, IHC-P, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Avian, Human, Mouse, Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), D. melanogaster (Drosophila melanogaster), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Fruit fly (Drosophila melanogaster), Insect, Yeast, Mallard (Anas platyrhynchos), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Sheep (Ovis aries) |
Clone | MO52008FYA |
Specificity | This antibody binds to Rhesus MYC. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. (From NCBI) |
Product Overview | Mouse Anti-Rhesus MYC Antibody is a mouse antibody against MYC. It can be used for MYC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | MYC; MYC |
UniProt ID | A2D666 |
Protein Refseq | The length of the protein is 251 amino acids long. The sequence is show below: MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECXXPSVVFPYPLNDSSSPKSCASPXXSAFSPSSDSLLSSTESSPQASPEPXVLHEETPPTTSSD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry