Mouse Anti-MYCT1 Antibody (CBMOAB-52020FYA)


Cat: CBMOAB-52020FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52020FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52020FYA 100 µg
CBMOAB-87969FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87969FYA 100 µg
MO-AB-27329H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27329C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52020FYA
SpecificityThis antibody binds to Rhesus MYCT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MYCT1 Antibody is a mouse antibody against MYCT1. It can be used for MYCT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMYCT1
UniProt IDF6QKJ5
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MPTQVYEGLCKNYFSLAVLQRHRIELLFFDILIFLSLFLLFLLFLVDIMANNTTSLGSPWPGNFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYSHGLNRTGFYRHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSSISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS.
For Research Use Only | Not For Clinical Use.
Online Inquiry