AibGenesis™ Mouse Anti-MyHC Antibody (MO-AB-16288R)


Cat: MO-AB-16288R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16288R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO16288R 100 µg
MO-AB-27338H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27338C 100 µg
MO-AB-27453R Monoclonal Pig (Sus scrofa) WB, ELISA MO27453R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO16288R
SpecificityThis antibody binds to Cattle MyHC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle MyHC Antibody is a mouse antibody against MyHC. It can be used for MyHC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyosin heavy chain embryonic, Fragment; MyHC
UniProt IDQ8MJU3
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: DAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLETRIRELESELEGEQKKNTESVKGLRKYERRVKELTYQSEEDRKNVLRLQDLVDKLQMKVKSYKRQAEEADEQANAHLTKFRKAQHELEEAEERADIAESQVNKLRAKTRDFTSSRMVVHESEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry