AibGenesis™ Mouse Anti-MYL12A Antibody (CBMOAB-52038FYA)


Cat: CBMOAB-52038FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52038FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO52038FYA 100 µg
MO-AB-24685W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24685W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO52038FYA
SpecificityThis antibody binds to Rhesus MYL12A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8. (From NCBI)
Product OverviewMouse Anti-Rhesus MYL12A Antibody is a mouse antibody against MYL12A. It can be used for MYL12A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMYL12A
UniProt IDF7AEV1
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: MDLTTTMSSKRAKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDDYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry