AibGenesis™ Mouse Anti-Naa20 Antibody (CBMOAB-25247FYA)


Cat: CBMOAB-25247FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25247FYA Monoclonal Fruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO25247FYA 100 µg
CBMOAB-88249FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88249FYA 100 µg
MO-AB-04581W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04581W 100 µg
MO-AB-25780W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25780W 100 µg
MO-AB-27371H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27371C 100 µg
MO-AB-59687W Monoclonal Marmoset WB, ELISA MO59687W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO25247FYA
SpecificityThis antibody binds to fruit fly Naa20.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Naa20 Antibody is a mouse antibody against Naa20. It can be used for Naa20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNAA20 ortholog, isoform B; EC 2.3.1.-; NAA20
UniProt IDM9PI14
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGDQDEDAYDMRKALSRDVNKKSVIPYTQPITMRELRRQMRHDH.
For Research Use Only | Not For Clinical Use.
Online Inquiry