AibGenesis™ Mouse Anti-NAA50 Antibody (CBMOAB-52168FYA)
Cat: CBMOAB-52168FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-52168FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO52168FYA | 100 µg | ||
| CBMOAB-88263FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO88263FYA | 100 µg | ||
| MO-AB-16350R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16350R | 100 µg | ||
| MO-AB-19117W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19117W | 100 µg | ||
| MO-AB-27374H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27374C | 100 µg | ||
| MO-AB-59692W | Monoclonal | Marmoset | WB, ELISA | MO59692W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO52168FYA |
| Specificity | This antibody binds to Rhesus NAA50. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine (PubMed:19744929, PubMed:22311970, PubMed:21900231, PubMed:27484799). Has a broad substrate specificity: able to acetylate the initiator methionine of most peptides, except for those with a proline in second position (PubMed:27484799). Also displays N-epsilon-acetyltransferase activity by mediating acetylation of the side chain of specific lysines on proteins (PubMed:19744929). Autoacetylates in vivo (PubMed:19744929). The relevance of N-epsilon-acetyltransferase activity is however unclear: able to acetylate H4 in vitro, but this result has not been confirmed in vivo (PubMed:19744929). Component of a N-alpha-acetyltransferase complex containing NAA10 and NAA15, but NAA50 does not influence the acetyltransferase activity of NAA10: this multiprotein complex probably constitutes the major contributor for N-terminal acetylation at the ribosome exit tunnel, with NAA10 acetylating all amino termini that are devoid of methionine and NAA50 acetylating other peptides (PubMed:16507339, PubMed:27484799). Required for sister chromatid cohesion during mitosis by promoting binding of CDCA5/sororin to cohesin: may act by counteracting the function of NAA10 (PubMed:17502424, PubMed:27422821). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Rhesus NAA50 Antibody is a mouse antibody against NAA50. It can be used for NAA50 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | NAA50 |
| UniProt ID | F7CQ64 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: SSSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry