Mouse Anti-Naa80 Antibody (MO-AB-02867W)


Cat: MO-AB-02867W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02867W Monoclonal Fruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes) WB, ELISA MO02867W 100 µg
MO-AB-22114W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22114W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes)
CloneMO02867W
SpecificityThis antibody binds to Fruit fly Naa80.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionN-alpha-acetyltransferase that acetylates the amino terminal acidic residue of proteins devoid of initiator methionine (PubMed:29581307). Preferentially acts on proteins starting with Asp-Asp-Asp and Glu-Glu-Glu sequences (PubMed:29581307). In vitro, shows high activity towards N-terminal sequences starting with Met-Asp-Glu-Leu, Met-Glu-Glu-Glu and Met-Asp-Asp-Asp (PubMed:29581307). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Fruit fly Naa80 Antibody is a mouse antibody against Naa80. It can be used for Naa80 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG8481, isoform A; EC 2.3.1.-; EC 3.4.21.-; GH04732p; Naa80
UniProt IDQ9VH73
Protein RefseqThe length of the protein is 168 amino acids long.
The sequence is show below: MGLPPFNVSGSPFNVVPIHNYPELMKDTCALINAEWPRSETARMRSLEASCDSLPCSLVLTTEGMCRVIAHLKLSPINSKKKACFVESVVVDKRHRGQGFGKLIMKFAEDYCRVVLDLKTIYLSTIDQDGFYERIGYEYCAPITMYGPRHCELPSLQNAKKKYMKKVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry