Mouse Anti-NANOS1 Antibody (CBMOAB-52219FYA)


Cat: CBMOAB-52219FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52219FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO52219FYA 100 µg
Inquiry
CBMOAB-88333FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88333FYA 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO52219FYA
SpecificityThis antibody binds to Rhesus NANOS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a CCHC-type zinc finger protein that is a member of the nanos family. This protein co-localizes with the RNA-binding protein pumilio RNA-binding family member 2 and may be involved in regulating translation as a post-transcriptional repressor. Mutations in this gene are associated with spermatogenic impairment. (From NCBI)
Product OverviewMouse Anti-Rhesus NANOS1 Antibody is a mouse antibody against NANOS1. It can be used for NANOS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNANOS1
UniProt IDF7H5H3
Protein RefseqThe length of the protein is 84 amino acids long.
The sequence is show below: PELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPRSARDGLPGKKLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry