AibGenesis™ Mouse Anti-NAP1L5 Antibody (MO-AB-11498W)


Cat: MO-AB-11498W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11498W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO11498W 100 µg
MO-AB-16375R Monoclonal Cattle (Bos taurus) WB, ELISA MO16375R 100 µg
MO-AB-27383H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27383C 100 µg
MO-AB-27542R Monoclonal Pig (Sus scrofa) WB, ELISA MO27542R 100 µg
MO-AB-59719W Monoclonal Marmoset WB, ELISA MO59719W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO11498W
SpecificityThis antibody binds to Chimpanzee NAP1L5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that shares sequence similarity to nucleosome assembly factors, but may be localized to the cytoplasm rather than the nucleus. Expression of this gene is downregulated in hepatocellular carcinomas. This gene is located within a differentially methylated region (DMR) and is imprinted and paternally expressed. There is a related pseudogene on chromosome 4. (From NCBI)
Product OverviewMouse Anti-Chimpanzee NAP1L5 Antibody is a mouse antibody against NAP1L5. It can be used for NAP1L5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNucleosome assembly protein 1-like 5; NAP1L5
UniProt IDK6ZF99
Protein RefseqThe length of the protein is 182 amino acids long.
The sequence is show below: MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGEMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEEEEEEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAEMPDDAKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry