AibGenesis™ Mouse Anti-NBR1 Antibody (CBMOAB-37182FYC)
Cat: CBMOAB-37182FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-37182FYC | Monoclonal | WB, ELISA | MO37182FC | 100 µg | |||
| CBMOAB-52292FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO52292FYA | 100 µg | ||
| CBMOAB-88415FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO88415FYA | 100 µg | ||
| MO-AB-05480H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05480C | 100 µg | ||
| MO-AB-10576W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10576W | 100 µg | ||
| MO-AB-16407R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16407R | 100 µg | ||
| MO-AB-27393H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27393C | 100 µg | ||
| MO-AB-59758W | Monoclonal | Marmoset | WB, ELISA | MO59758W | 100 µg | ||
| MO-DKB-0340RA | Polyclonal | WB | 50 µL |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); P. patens (Physcomitrella patens), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO37182FC |
| Specificity | This antibody binds to Arabidopsis NBR1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled-coil motif, which is present in many genes with transformation potential. It functions as a specific autophagy receptor for the selective autophagic degradation of peroxisomes by forming intracellular inclusions with ubiquitylated autophagic substrates. This gene is located on a region of chromosome 17q21.1 that is in close proximity to the BRCA1 tumor suppressor gene. Alternative splicing of this gene results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis NBR1 Antibody is a mouse antibody against NBR1. It can be used for NBR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | NBR1, Autophagy Cargo Receptor; Membrane Component, Chromosome 17, Surface Marker 2 (Ovarian Carcinoma Antigen CA125); Cell Migration-Inducing Gene 19 Protein; Neighbor Of BRCA1 Gene 1; M17S2; Membrane Component Chromosome 17 Surface Marker 2; Neighbor Of BRCA1 Gene 1 Protein; Migration-Inducing Protein 19; Next To BRCA1 Gene 1 Protein |
| UniProt ID | S4X733 |
| Protein Refseq | The length of the protein is 415 amino acids long. The sequence is show below: TNQRLKFLKINVNAGVSTNSAAPESSGSSTPAGMPNPVSKIQKGINDVLMAVPNPMRDTISKVYMDLASKASTSSPVVGEMLDCISKLGQLSIPQESSPCSPVTKPGSSGASLSRDVPSAGGKKDISERTQTGRKPVNLNEPTGAHSKTSGHVPNSSGLGANFNECPFSGSTMNYSCPNPVNLNKHPRRVCHSKKSTNGDYWTSLGVFHKGIRCDGCGVLPITGPRFKSKVKEDYDLCTICYSVMGNEGDYTRMDKPVSVQHLHPFRGPFTQFPNPWLSHPVPRATNGGAPLRCTRPKLDSRFVLDVNVIDGTVVAPSAPFTKIWKMRNSGSLVWPQGTQIVWIGGDRFCNSLSVDLQIPKEGVPIYSELDVKVDFVAPELPGRYISYWRMATSDGAKFGQRVWVLIHVDASLKN. |
Reference
| Reference | 1. Jung, H., Lee, H. N., Marshall, R. S., Lomax, A. W., Yoon, M. J., Kim, J., ... & Chung, T. (2020). Arabidopsis cargo receptor NBR1 mediates selective autophagy of defective proteins. Journal of experimental botany, 71(1), 73-89. 2. Thirumalaikumar, V. P., Gorka, M., Schulz, K., Masclaux-Daubresse, C., Sampathkumar, A., Skirycz, A., ... & Balazadeh, S. (2021). Selective autophagy regulates heat stress memory in Arabidopsis by NBR1-mediated targeting of HSP90. 1 and ROF1. Autophagy, 17(9), 2184-2199. 3. Tarnowski, L., Rodriguez, M. C., Brzywczy, J., Piecho-Kabacik, M., Krčkova, Z., Martinec, J., ... & Sirko, A. (2020). A selective autophagy cargo receptor NBR1 modulates abscisic acid signalling in Arabidopsis thaliana. Scientific Reports, 10(1), 7778. |
For Research Use Only | Not For Clinical Use.
Online Inquiry