AibGenesis™ Mouse Anti-NCOA5 Antibody (CBMOAB-52333FYA)


Cat: CBMOAB-52333FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52333FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO52333FYA 100 µg
CBMOAB-88509FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88509FYA 100 µg
MO-AB-05501H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05501C 100 µg
MO-AB-16437R Monoclonal Cattle (Bos taurus) WB, ELISA MO16437R 100 µg
MO-AB-21160W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21160W 100 µg
MO-AB-59817W Monoclonal Marmoset WB, ELISA MO59817W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO52333FYA
SpecificityThis antibody binds to Rhesus NCOA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a coregulator for the alpha and beta estrogen receptors and the orphan nuclear receptor NR1D2. The protein localizes to the nucleus, and is thought to have both coactivator and corepressor functions. Its interaction with nuclear receptors is independent of the AF2 domain on the receptors, which is known to regulate interaction with other coreceptors. Several alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus NCOA5 Antibody is a mouse antibody against NCOA5. It can be used for NCOA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNuclear receptor coactivator 5; NCOA5
UniProt IDH9YZC6
Protein RefseqThe length of the protein is 579 amino acids long.
The sequence is show below: MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDHRHSRDLRDHRDSRSMRDVRDMRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPLYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPTPSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAPNSQPQQRSQASGNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMASQRPVSSTGINFDNPSVQKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY.
For Research Use Only | Not For Clinical Use.
Online Inquiry