Mouse Anti-NCR1 Antibody (MO-AB-16440R)


Cat: MO-AB-16440R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16440R Monoclonal Cattle (Bos taurus), Sheep (Ovis aries), Dog (Canis lupus familiaris), Pig (Sus scrofa), Yeast WB, ELISA MO16440R 100 µg
CBMOAB-00062FYA Monoclonal Cattle (Bos taurus), Sheep (Ovis aries) FC F00062FYA 100 µg
CBMOAB-02561CR Monoclonal Yeast WB, ELISA MO02561CR 100 µg
MO-AB-31895W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31895W 100 µg
MO-AB-27561R Monoclonal Pig (Sus scrofa) WB, ELISA MO27561R 100 µg
MO-AB-16256Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16256Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Sheep (Ovis aries), Dog (Canis lupus familiaris), Pig (Sus scrofa), Yeast
CloneMO16440R
SpecificityThis antibody binds to Cattle NCR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Product OverviewMouse Anti-Cattle NCR1 Antibody is a mouse antibody against NCR1. It can be used for NCR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNCR1; NCR1
UniProt IDA0A075CE27
Protein RefseqThe length of the protein is 309 amino acids long.
The sequence is show below: MPSTLAVFLVLGGLGLSQRSSTQKQMLSKPAIWVRPSFMIPKGRSATIGCRGAGEAMEYQLHFEGGLSALKRPKSSPVMNWVKFPIPAMTSHTAGQYRCSYRSGELWSELSDPLELVVTGLYDTPTLSVEPRSEVTSGENVTFHCQLATATSTFFLLKKGRSSRPQLRYGNLRAEFHLGPVTPAHGGTYRCFGSYNNHAWSFPSKPVKLLVKVPGDAGDTTFAPTEHTSSDYWDSYELTTGTQSQKDHLLWNHMI.
For Research Use Only | Not For Clinical Use.
Online Inquiry