Mouse Anti-ndhK Antibody (CBMOAB-34967FYB)


Cat: CBMOAB-34967FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34967FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Sugar beet (Beta vulgaris) WB, ELISA MO34967FYB 100 µg
CBMOAB-37245FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO37245FC 100 µg
MO-AB-00385W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00385W 100 µg
MO-AB-30327H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30327C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Sugar beet (Beta vulgaris)
CloneMO34967FYB
SpecificityThis antibody binds to Rice ndhK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.
Product OverviewMouse Anti-Rice ndhK Antibody is a mouse antibody against ndhK. It can be used for ndhK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNAD(P)H-quinone oxidoreductase subunit K, chloroplastic; EC 1.6.5.-; NAD(P)H dehydrogenase subunit K; NADH-plastoquinone oxidoreductase subunit K; ndhK
UniProt IDE9KIP4
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: MAKRSLGMVLTEYSDKKKKEGKDSIKTVMSLIEFPLLDQTSSNSVISTTLKDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDALTKLRKKISREIVEDRTLSQKKNRCFTTSHKLYVRRSTNTGTYEQELLYQSPSTLDISSETFFKSKSPVSSYKLVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry