AibGenesis™ Mouse Anti-ndr2 Antibody (CBMOAB-88565FYA)


Cat: CBMOAB-88565FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88565FYA Monoclonal Zebrafish (Danio rerio), Medaka (Oryzias latipes) WB, ELISA MO88565FYA 100 µg
MO-AB-01021R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01021R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Medaka (Oryzias latipes)
CloneMO88565FYA
SpecificityThis antibody binds to Zebrafish ndr2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ndr2 Antibody is a mouse antibody against ndr2. It can be used for ndr2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclops; Neurogenic differentiation factor 2; Znr-1; ndr
UniProt IDP87358
Protein RefseqThe length of the protein is 501 amino acids long.
The sequence is show below: MHALGVARLACYCQLLLLGVFGKHTRYRHNNYNSLRNMSHRMHLPTYMMHLYRHYKMNQTRIPAESLEHEHADTIRSIMSKNVLNNDNHYVAIFDLSPVLSERQIQAAELRIRVPRDLHPDGLTLELQHQQGAPCPRHQPCPKSQSLGLLPEESLLSVTQHWRVYNVTNLLLHWPRPRTSPRSRVKTKRPAAAPGGKEIHSGPRRPAAAPGGQELQRRPRRPAVAPEEQELPSRPRRPAVAPGAQELQSGPQRPAAAPGGQKIQNRPRRPSAAPKGQEVQSRPSRPATAPRGQELQSAPQRPVVAPGGREIHSRPWLPAATPGGQEIQNGTQKHRAMLLLFSEQQDGASLLHTAGASKFLFSRNKKEVKRGRALRSRRGRRGPPVRSPELQRTPLHKSTTCRRVDMHVDFNQIGWGSWIVFPKKYNAYRCEGACPNPLGEELRPTNHAYMQSLLKYHHPSRVPASCCAPTRTSALSMLYYENGEMILRHHEDMQVEECGCL.
For Research Use Only | Not For Clinical Use.
Online Inquiry