Mouse Anti-NEK2 Antibody (MO-AB-16655R)


Cat: MO-AB-16655R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16655R Monoclonal Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Zebrafish (Danio rerio) WB, ELISA MO16655R 100 µg
CBMOAB-25534FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO25534FYA 100 µg
CBMOAB-88732FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88732FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Fruit fly (Drosophila melanogaster), Zebrafish (Danio rerio)
CloneMO16655R
SpecificityThis antibody binds to Cattle NEK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a serine / threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene.
Product OverviewThis product is a mouse antibody against NEK2. It can be used for NEK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNIMA (Never in mitosis gene a)-related kinase 2; NEK2
UniProt IDQ2KIQ0
Protein RefseqThe length of the protein is 383 amino acids long.
The sequence is show below: MPTRVEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTENEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMECCEGGDLASVIAKGTKERQYLDEEFVLRVMAQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNHMSYNEKSDIWSLGCLLYELCALMPPFTAFNQKELAGKIREGKFRRIPYRYSDELNDIITRMLNLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry